PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33687.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 238aa    MW: 27161.8 Da    PI: 7.9354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33687.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181561148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd llv++v+ +G++ W+ Ia+++  gR +kqc++rw+++l
       KFK33687.1 15 KGQWTSEEDRLLVQLVESHGTKKWSQIAKMLE-GRVGKQCRERWHNHL 61
                     799*****************************.*************97 PP

2Myb_DNA-binding52.89.1e-1767109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd +l++a+k+ G++ W+  ar+++ gRt++ +k++w+
       KFK33687.1  67 KDVWSEEEDRILIEAHKEIGNK-WAEMARKLP-GRTENTIKNHWN 109
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.0511065IPR017930Myb domain
SuperFamilySSF466897.7E-3212108IPR009057Homeodomain-like
SMARTSM007171.4E-161463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-281668IPR009057Homeodomain-like
PfamPF139211.6E-171872No hitNo description
CDDcd001679.70E-151861No hitNo description
PROSITE profilePS5129419.58166116IPR017930Myb domain
SMARTSM007172.3E-1566114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2169114IPR009057Homeodomain-like
CDDcd001673.42E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MRRGCKSIKK ANIIKGQWTS EEDRLLVQLV ESHGTKKWSQ IAKMLEGRVG KQCRERWHNH  60
LRPDIKKDVW SEEEDRILIE AHKEIGNKWA EMARKLPGRT ENTIKNHWNA TKRRQHSRRA  120
KGKDEISLAL GSNTLQNYIR SVTYNDDTLL TMSSTNANPN DGPENMREEG TQTLPLELMT  180
TTCESGSSST CDSVSVSRSG VTTEIDEPMT DSWMVMHGCD EVMLKEIALL EMIAHGRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-47131152104MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-47131152104C-Myb DNA-Binding Domain
1msf_C7e-47131152104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010425555.11e-121PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L26e-63MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A087GUY51e-177A0A087GUY5_ARAAL; Uncharacterized protein
STRINGAT3G27785.11e-118(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-119myb domain protein 118